SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015184 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015184
Domain Number 1 Region: 454-545
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.27e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 323-494
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-27
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015184   Gene: ENSGGOG00000015564   Transcript: ENSGGOT00000015619
Sequence length 638
Comment pep:known_by_projection chromosome:gorGor3.1:5:97448809:97593089:1 gene:ENSGGOG00000015564 transcript:ENSGGOT00000015619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPPPPRSSHLHCQQQQQSQDKPCPPFAPLPHPHHHPHLAHQQPASGGSSPCLRCNSCAS
SGAPAAGAGDNLSLLLRTSSPGDPPHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLS
NLSASRRNLHEMDSEAQPLQPPASAPEIVVSKPEHNNSNNLALYGTKSSKKKNQNIGYKL
GHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIIL
LGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARL
AFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFV
MKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGY
GDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKN
AAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVD
LAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIE
AQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences ENSGGOP00000015184 ENSGGOP00000015184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]