SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015205 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015205
Domain Number 1 Region: 420-519
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015205   Gene: ENSGGOG00000015585   Transcript: ENSGGOT00000015640
Sequence length 520
Comment pep:known_by_projection chromosome:gorGor3.1:2b:5753032:5805448:1 gene:ENSGGOG00000015585 transcript:ENSGGOT00000015640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRNKKILKEDELLSETQQAAFHQIAMEPFEINVPKPKRRNGVNFSLAVVVIYLILLTAGA
GLLVVQVLNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSTHPREHLAQGASRLQVLQAQL
TWVRVSHEHLLQRVDNFTQNPGMFGIKGEQGAPGLQGHKGAMGMPGAPGPPGPPAEKGAK
GAAGRDGATGPPGPQGPPGVKGEAGLQGPQGAPGKQGATGTPGPQGEKGSKGDGGLIGPK
GETGTKGEKGDLGLPGSKGDRGMKGDAGVMGPPGAQGSKGDSGRPGAPGLAGFPGAKGDQ
GQPGLQGVPGPPGAVGHPGAKGEPGSAGSPGRAGLPGSPGSPGATGLKGSKGDTGLQGQQ
GRKGELGVPGPAGVKGEQGSPGLAGPKGAPGQAGQKGDQGVKGSSGEQGVKGEKGERGEN
SVSVRIVGSSNRGRAEVYYSGIWGTICDDEWHNSDATVFCRMLGYSKGRALYKVGAGTGQ
IWLDNVQCRGTESTLWSCIKNSWGYHDCSHEEDAGVECSV
Download sequence
Identical sequences G3RHS7
ENSGGOP00000015205 XP_004031716.1.27298 ENSGGOP00000015205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]