SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015219 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015219
Domain Number 1 Region: 559-669
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 720-826
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 409-512
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-35
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 294-403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 5 Region: 850-943
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 6 Region: 154-287
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.26e-25
Family Astacin 0.0074
Further Details:      
 
Domain Number 7 Region: 670-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000259
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 514-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000381
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015219   Gene: ENSGGOG00000015595   Transcript: ENSGGOT00000015654
Sequence length 954
Comment pep:known_by_projection chromosome:gorGor3.1:10:109707197:109853746:-1 gene:ENSGGOG00000015595 transcript:ENSGGOT00000015654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATALEALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAG
KDGQENTTLPHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIF
KQAMRHWEKHTCVTFIERTDEESFIVFSYRTCQEYNFLKMEAGEVSSLGETYDFDSIMHY
ARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGN
FSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPL
LGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNYP
DDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALMGHFCGY
EKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKC
ACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQ
FEVFELEGNDVCKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSDNTVS
KRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYQLHENGHDCKEAGCAHKIS
SVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPD
SLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKE
LYSHAQFGDNNYPSQAHCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSA
PRLGRFCGSGPLEEIYSAGDSLMIRFCTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences ENSGGOP00000015219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]