SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015233 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015233
Domain Number 1 Region: 67-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.32e-52
Family Astacin 0.00013
Further Details:      
 
Domain Number 2 Region: 354-520
Classification Level Classification E-value
Superfamily TRAF domain-like 2.13e-34
Family MATH domain 0.0014
Further Details:      
 
Domain Number 3 Region: 264-355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000364
Family MAM domain 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015233
Domain Number - Region: 534-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000141
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015233   Gene: ENSGGOG00000015610   Transcript: ENSGGOT00000015668
Sequence length 629
Comment pep:known_by_projection chromosome:gorGor3.1:18:29413823:29443265:1 gene:ENSGGOG00000015610 transcript:ENSGGOT00000015668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLWSLSWFLFLDALLVISGLPTPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQI
RNSIIGEKYRWPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFK
GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRI
LSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMD
FSDSDLLKLNQLYNCTSSLSFMDSCSFELENVCGMIQSSGDNADWQRVSQVPRGPESDHS
NMGQCQEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDINLSETRCPHHIW
HIRNFKQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQWPC
PWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFPNGTQFR
RGGGYGTSAFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTT
CKNDGVCTVRDGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITL
VSVYCTRKKYRERMSSNRPNLTPQNQHAF
Download sequence
Identical sequences ENSGGOP00000015233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]