SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015242 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015242
Domain Number 1 Region: 12-343
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.03e-108
Family Calpain large subunit, catalytic domain (domain II) 0.000000382
Further Details:      
 
Domain Number 2 Region: 347-483
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 2.62e-21
Family Calpain large subunit, middle domain (domain III) 0.0043
Further Details:      
 
Domain Number 3 Region: 494-667
Classification Level Classification E-value
Superfamily EF-hand 4.24e-21
Family Penta-EF-hand proteins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015242   Gene: ENSGGOG00000015615   Transcript: ENSGGOT00000015677
Sequence length 669
Comment pep:known_by_projection chromosome:gorGor3.1:2a:31287348:31372980:-1 gene:ENSGGOG00000015615 transcript:ENSGGOT00000015677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYYQEPSVETSIIKFKDQDFTTLRDHCLSMGQTFKDETFPAADSSIGQKLLQEKRLSNV
IWKRPQDLPGGPPHFILDDISRFDIRQGGAADCWFLAALGSLTQNPQYRQKILMVQSFSH
QYAGIFRFRFWQCGQWVEVVIDDRLPVQGDKCLFVHPCHQNQEFWPCLLEKAYAKLLGSY
SDLHYGFLEDALVDLTGGVITNIHLHSSPVDLVKAVKTATKAGSLITCATPSGPTDTAQA
MENGLVSLHAYTVTGAEQIQYRSGWEEIISLWNPWGWGETEWRGRWSDGSQEWEETCDPR
KSQLYKKREDGEFWMSCQDFQQKFIAMFICSEIPITLDHGNTLHEGWSQIMFRKQVILGN
TAGGPRNDAQFNFSVQEPVEGTNVVVCITVAVTPSNLKAEDAKFPLDFQVTMVRFQRFRE
KFPPVFFSSFGNTVQSSNNKFRRNFTRTYHLSPGNYVVVAQTRRKSVEFLLRIFLKMPDS
DRHLNSHFNLRMKGSPSEHGSQQSIFNRYAQQRLDIDATQLQGLLNQELLTGPPGDMFSL
DECRSLVALMELKVNGRLDQEEFAQLWKHLVHYQHVFQKVQTSPGVLLSSDLWKAIENTD
FLRGIFISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEM
EWMSLVMYN
Download sequence
Identical sequences ENSGGOP00000015242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]