SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015257 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015257
Domain Number 1 Region: 9-124
Classification Level Classification E-value
Superfamily POZ domain 2.67e-24
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 358-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000383
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 396-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000125
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015257
Domain Number - Region: 331-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000893
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 166-175
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0144
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015257   Gene: ENSGGOG00000015638   Transcript: ENSGGOT00000015692
Sequence length 459
Comment pep:novel chromosome:gorGor3.1:6:32797430:32800688:-1 gene:ENSGGOG00000015638 transcript:ENSGGOT00000015692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVADSLKFRGHKVILAACSPFLRD
QFLLNPSSELQVSLMHSARIVADLLLSCYTGALEFAVRDIVNYLTAASYLQMEHVVEKCR
NALSQFIEPKIGLKEDGVSEASLVSSVSATKSLLPPARTPKPAPKPPPPPPLPPPLLRPV
KLEFPLDEDLELKAEDEDEDEDEDVSDICIVKVESALEVAHRLKPPGGLGGGLGIGGSVG
GHLGELAQSSVPPSTVAPPQGVVKACYSLSEDAEGEGLLLIPGGRASVGATSGLMEAAAV
AMAARGAGGSLGAGGSRGPLPGGFSGGNPLKNIKCTKCPEVFQGVEKLVFHMRGQHFIFM
CPRCGKQFNHSSNLNRHMNVHRGVKSHSCGICGKCFTQKSTLHDHLNLHSGARPYRCSYC
DVRFAHKPAIRRHLKEQHGKTTAENVLEASVAEINVLIR
Download sequence
Identical sequences ENSGGOP00000015257 ENSGGOP00000015257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]