SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015300 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015300
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000143
Family THAP domain 0.00094
Further Details:      
 
Domain Number 2 Region: 364-424
Classification Level Classification E-value
Superfamily Lipocalins 0.0000365
Family Rv2717c-like 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015300
Domain Number - Region: 269-364
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0314
Family MED7 hinge region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015300   Gene: ENSGGOG00000015684   Transcript: ENSGGOT00000015737
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:2b:131085304:131136938:-1 gene:ENSGGOG00000015684 transcript:ENSGGOT00000015737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLEDQHRLLKPTAVPSIFH
LTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATGRGAAGWSPSSSGNPMAKPESRRLKR
AALQGEATPRAAQEAASQEQAQQALERTPGDGLATMVAGSQGKAEASATDASDESATSSI
EGGVADKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRPKKDVE
PSCSGSSLGPDKGLAQSPPSSSLTATPQKPSQSPSAPPADVTPKPATEAVQSEHSDASPM
SINEVILSASGACKLIDSLHSYCFSSRQNKSQVCCLREQVEKKNGELKSLRQRVSRSDSQ
VRKLQEKLDELRRVSIPYPSGLLSPSRITRKFRLNSEGKLEQTVSMATTTQPMTQHLHVT
YKKVTP
Download sequence
Identical sequences ENSGGOP00000015300 ENSGGOP00000015300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]