SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015333 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015333
Domain Number 1 Region: 209-382
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-52
Family C-type lectin domain 0.0000000558
Further Details:      
 
Domain Number 2 Region: 94-158
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000981
Family Occludin/ELL domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015333   Gene: ENSGGOG00000005655   Transcript: ENSGGOT00000015771
Sequence length 388
Comment pep:known_by_projection chromosome:gorGor3.1:19:7954475:7959327:-1 gene:ENSGGOG00000005655 transcript:ENSGGOT00000015771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSKEPRLQQLGLLEETARGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAALLVQVS
KVPSSISQEQSRQDAIYQNLTQFKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKQQ
EIYQELSQLKAAVGELPEKSKQQEIYQELSQLKAAVGELPEKSKQQEIYQELTRLKAAVG
ELPEKSKQQEIYQELTELKAAVGELPEKSKQQEIYQELTQLKAAVGELPEKSKQQEIYQE
LTQLKAAVERLCRRCPWEWTFFQGNCYFMSNSQRNWHDSITACQEVGAQLVVIKSAEEQN
FLQLQSSRSNRFTWMGLSDLNHEGTWQWVDGSPLLPSFEQYWNRGEPNNVGEEDCAEFSG
NGWNDDKCNLAKFWICKKSAASCSRDEE
Download sequence
Identical sequences ENSGGOP00000015333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]