SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015393 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015393
Domain Number 1 Region: 314-364
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 586-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000384
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 669-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000019
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 4 Region: 471-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000111
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number 5 Region: 629-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000725
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 554-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000191
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 7 Region: 436-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000432
Family Classic zinc finger, C2H2 0.045
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015393
Domain Number - Region: 181-192
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 40-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00168
Family C2HC finger 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015393   Gene: ENSGGOG00000015775   Transcript: ENSGGOT00000015833
Sequence length 846
Comment pep:known_by_projection chromosome:gorGor3.1:20:31085413:31140011:1 gene:ENSGGOG00000015775 transcript:ENSGGOT00000015833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCKKQFNSLPAF
MTHKREQCQGNAPALATVSLATNSIYPPSAAPTAVQQAPTPANRQISTYITVPPSPLIQT
LVQGNILVSDDVLMSAMSAFTSLDQPMPQGPPPVQSSLNMHSVPSYLTQPPPPPPPPPPL
PPPPPPQPPPPPPQSLGPPGRPNPGGNGVVEVYSAAAPLAGSGTVEIQALGMQTYPPLEV
PNQCVEPPVYPTPTVYSPGKQGFKPKGPNPAAPMTSATGGTVATFDSPATLKTRRAKGAR
GLLEAAGKPKAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQKSNVKKH
MQTHKVWPPGHSGGTVSRNSVTVQVMALNPSRQEDEESTGLGQPLPGAPQPQALSTAGEE
EGDKPEPKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKCVVKSCAQTFPKLD
TFLEHIKSHQEELSYRCHLCGKDFPSLYDLGVHQYSHSLLPQHSPRKDNAVYKCVKCVNK
YSTPEALEHHLQTATHNFPCPHCQKVFPCERYLRRHLPTHGSGGRFKCQVCKKFFRREHY
LKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGCSKEFNRPD
KLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRHKYLKD
HRCRLGPQKDKDLQTRRPPQRRAAPRSCGSGGRKVVTPLPDPLGLEELKDTGAGLVPEAV
PGKPPFAEPDAVLSIVVGGAVGTEPELVVPGHAEGLGSNLALAELQAGAEGPCAMLAVPV
YIQASE
Download sequence
Identical sequences ENSGGOP00000015393 ENSGGOP00000018127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]