SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015395 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015395
Domain Number 1 Region: 366-492
Classification Level Classification E-value
Superfamily SH2 domain 8.75e-26
Family SH2 domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015395   Gene: ENSGGOG00000015778   Transcript: ENSGGOT00000015835
Sequence length 495
Comment pep:known_by_projection chromosome:gorGor3.1:1:133481386:133499322:-1 gene:ENSGGOG00000015778 transcript:ENSGGOT00000015835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQWSPTPGASACLGWASSLACSTAPTLLGRAGRGPLMAAKWFKEFPLNLKTVSERAKPGG
GGGKLRKNSEAGGAGPGPGKGRKNSAAELGSGRAGVGPKDSRLSRDSLQGLIQAAAGKGR
KNSRATEEEPHRGATKSSGCSTYINRLIKVDTQEKNGKSSYPSSSSSSSSSSSSASSSPS
SLGPELDKGKIIKQQDTVIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYDAQQMITE
IRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPYEPAEGG
PRAEGKARPPDSRLPENDERPAAEYEQPWEWKKEQIVRALSVQFEGAERPSVREETVRQH
HRQKSWTQKILKPALSDHSEGEKVDPGLPLEKQPWYHGAISRAEAESRLQPCKEAGYLVR
NSESGNSRYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNEKLPFKG
AEHMTLLYPVHSKLH
Download sequence
Identical sequences G3SID3
ENSGGOP00000015395 ENSGGOP00000015395 XP_004026866.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]