SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015399 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015399
Domain Number 1 Region: 32-361
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.83e-106
Family Glycosyl hydrolases family 35 catalytic domain 0.0000811
Further Details:      
 
Domain Number 2 Region: 476-517,544-649
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.97e-38
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015399   Gene: ENSGGOG00000015782   Transcript: ENSGGOT00000015840
Sequence length 677
Comment pep:known_by_projection chromosome:gorGor3.1:3:33893727:33995913:-1 gene:ENSGGOG00000015782 transcript:ENSGGOT00000015840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGFLVRILPLLLALLLLGPTRALRNATQRMFEIDYSRDCFLKDGQPFRYISGSIHYSRV
PRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVIL
RPGPYICAEWEMGGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPV
ITVQVENEYGSYFACDFDYLRFLQKRFRRHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
DFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARG
ASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKV
PEGPIPPSTPKFAYGKVALEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT
TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENM
GRVNYGAYINDFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHRDEAWA
HSSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLT
LFVPQHILMTSAPNTITVLELERAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
LMPPPPQKNKDSWLDHV
Download sequence
Identical sequences ENSGGOP00000015399 ENSGGOP00000015399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]