SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015416 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015416
Domain Number 1 Region: 594-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-64
Family SPRY domain 0.0000024
Further Details:      
 
Domain Number 2 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 6.59e-24
Family Pyrin domain, PYD 0.0035
Further Details:      
 
Domain Number 3 Region: 366-431
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.11e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015416   Gene: ENSGGOG00000015800   Transcript: ENSGGOT00000015859
Sequence length 781
Comment pep:known_by_projection chromosome:gorGor3.1:16:3429168:3443109:-1 gene:ENSGGOG00000015800 transcript:ENSGGOT00000015859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVEKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGKEGNGPRPYGGGAASLRCSQPEAGRGLSRKLLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRAPERDQAEVRLRRNASSAGRLQGMAGGAPGRKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEETTAANLDSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPHCHAQEGDPVGGTCEHDSCSCPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHMKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEVLKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VPVPEHWTTPQEIKQKIQLLHRKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGP
D
Download sequence
Identical sequences G3RIB8
XP_004057123.1.27298 ENSGGOP00000015416 ENSGGOP00000015416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]