SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015442 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015442
Domain Number 1 Region: 10-306
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.46e-59
Family WD40-repeat 0.00052
Further Details:      
 
Domain Number 2 Region: 417-575
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.05e-36
Family Cofilin-like 0.001
Further Details:      
 
Domain Number 3 Region: 298-406
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.84e-30
Family Cofilin-like 0.0000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015442   Gene: ENSGGOG00000015810   Transcript: ENSGGOT00000015887
Sequence length 599
Comment pep:novel chromosome:gorGor3.1:3:53567816:53617315:-1 gene:ENSGGOG00000015810 transcript:ENSGGOT00000015887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLY
SKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDD
TFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFD
KGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYANSKA
VTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGPITCLQFNPKFMTFASA
CSNMLVLGASQEPVGRWDQDYDRAVLPLLDAQQPCYLLYRLDSQNAQGFEWLFLAWSPDN
SPVRLKMLYAATRATVKKEFGGGHIKDELFGTVKDDLSFAGYQKHLSSCAAVKTEISVES
KHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP
RDAARYHFFLYKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFHLE
IAKKIEIGDGAELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS
Download sequence
Identical sequences ENSGGOP00000015442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]