SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015463 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015463
Domain Number 1 Region: 226-484
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.26e-52
Family Glycerophosphoryl diester phosphodiesterase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015463   Gene: ENSGGOG00000015848   Transcript: ENSGGOT00000015908
Sequence length 605
Comment pep:known_by_projection chromosome:gorGor3.1:11:72464791:72557938:-1 gene:ENSGGOG00000015848 transcript:ENSGGOT00000015908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRHQPLQYYEPQLCLSCLTGIYGCRWKRYQRSHDDTTPWERLWFLLLTFTFGLTLIWLY
FWWEVHNDYDEFNWYLYNRLGYWSDWPVPILVTTAAAFAYIAGLLVLALCHIAVGQQMNL
HWLHKVGLVVILASTVVAMSAVAQLWEDEWEVLLISLQGTAPFLHVGALAAVTMLSWIVA
GQFARAERTSSQVTILCTFFTVVFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLA
PEHTLMSFRKALEQKLYGLQADITISLDGVPFLMHDTTLRRTTNVEEEFPELARRPASML
NWTTLQRLNAGEWFLKTDPFWTASSLSPSDHREAQNQSICSLAELLELAKGNATLLLNLR
DPPREHPYRSSFINVTLEAVLHSGFPQHQVMWLPSRQRPLVRKVAPGFQQTSGSKEAVAS
LRRGHIQRLNLRYTQVSRQELRDYASWNLSVNLYTVNAPWLFSLLWCAGVPSVTSDNSHT
LSQVPSPLWIMPPDEYCLMWVTADLVSFTLIVGIFVLQKWRLGGIRSYNPEQIMLSAAVR
RTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTATPVGPRGGGSCNKTLI
ERSGR
Download sequence
Identical sequences G3RIG1
ENSGGOP00000015463 ENSGGOP00000015463 XP_004051872.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]