SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015496 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015496
Domain Number 1 Region: 259-538
Classification Level Classification E-value
Superfamily SPOC domain-like 2.35e-86
Family Ku70 subunit middle domain 0.000000000145
Further Details:      
 
Domain Number 2 Region: 38-258
Classification Level Classification E-value
Superfamily vWA-like 1.38e-59
Family Ku70 subunit N-terminal domain 0.00000000255
Further Details:      
 
Domain Number 3 Region: 565-613
Classification Level Classification E-value
Superfamily SAP domain 0.00000000000061
Family SAP domain 0.0000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015496   Gene: ENSGGOG00000015885   Transcript: ENSGGOT00000015941
Sequence length 614
Comment pep:known_by_projection chromosome:gorGor3.1:22:25978784:26022839:1 gene:ENSGGOG00000015885 transcript:ENSGGOT00000015941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVANMSGWESYYKTEGDEEAEEEQEENLEASGDYKYSGRDSLIFLVDASKAMFESQSEDE
LTPFDMSIQQCIQSVYISKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQELDNPGAKR
ILELDQFKGQQGQKRFQDLMGHGSDYSLSEVLWVCANLFSDVQFKMSHKRIMLFTNEDNP
HGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEE
SSKLEDLLRKVRAKETRKRALSRLKLKLNKDIVISVGIYNLVQKALKPPPIKLYRETNEP
VKTKTRTFNTSTGGLLLPSDTKRSQIYGSRQIILEKEETEELKRFDDPGLMLMGFKPLVL
LKKHHYLRPSLFVYPEESLVIGSSTLFSALLIKCLEKEVAALCRYTPRRNIPPYFVALVP
QEEELDDQKIQVTPPGFQLVFLPFADDKRKMPFTEKIMATPEQVGKMKAIVDKLRFTYRS
DSFENPVLQQHFRNLEALALDLMEPEQAVDLTLPKVEAMNKRLGSLVDEFKELVYPPDYN
PEGKVTKRKHDNEGSGSKRPKVEYSEEELKTHISKGTLGKFTVPMLKEACRAYGLKSGLK
KQELLEALTKHFQD
Download sequence
Identical sequences ENSGGOP00000015496 ENSGGOP00000015496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]