SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015507 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015507
Domain Number 1 Region: 114-279
Classification Level Classification E-value
Superfamily EF-hand 3.23e-44
Family Penta-EF-hand proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015507   Gene: ENSGGOG00000015897   Transcript: ENSGGOT00000015952
Sequence length 284
Comment pep:known_by_projection chromosome:gorGor3.1:1:32708712:32723703:-1 gene:ENSGGOG00000015897 transcript:ENSGGOT00000015952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASYPYRQGCPGVAGQAPGAPPGSYYPGPPSSGGQYGSGLPPGGGYGGPAPGGPYGPPAG
GGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAY
SWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALW
KFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQL
DRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML
Download sequence
Identical sequences G3RIK0
ENSGGOP00000015507 XP_004025394.1.27298 ENSGGOP00000015507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]