SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015532 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015532
Domain Number 1 Region: 8-159
Classification Level Classification E-value
Superfamily EF-hand 5.79e-45
Family Calmodulin-like 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015532   Gene: ENSGGOG00000015926   Transcript: ENSGGOT00000015977
Sequence length 161
Comment pep:known_by_projection chromosome:gorGor3.1:3:53794578:53797527:-1 gene:ENSGGOG00000015926 transcript:ENSGGOT00000015977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
Download sequence
Identical sequences G3RIM2 H2PAJ6 H2QMR7 P02591 P63316 Q6FH91
gi|4507615|ref|NP_003271.1| ENSPPYP00000015449 ENSP00000232975 ENSPPYP00000015449 ENSGGOP00000015532 NP_003271.1.87134 NP_003271.1.92137 XP_001172150.1.37143 XP_002713286.1.1745 XP_002813699.1.23681 XP_003818806.1.60992 XP_004034331.1.27298 XP_004581584.1.84141 XP_006917622.1.64745 XP_007950244.1.48129 XP_011370867.1.92234 XP_015977357.1.101085 ENSP00000232975 ENSP00000232975 ENSOCUP00000006896 9598.ENSPTRP00000025903 9600.ENSPPYP00000015449 9606.ENSP00000232975 9986.ENSOCUP00000006896 ENSOCUP00000006896 ENSGGOP00000015532 ENSPTRP00000025903 ENSPTRP00000025903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]