SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015538 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015538
Domain Number 1 Region: 243-284
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000109
Family SOCS box-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015538   Gene: ENSGGOG00000015933   Transcript: ENSGGOT00000015983
Sequence length 285
Comment pep:known_by_projection chromosome:gorGor3.1:20:43730100:43732743:-1 gene:ENSGGOG00000015933 transcript:ENSGGOT00000015983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASKPVDSGALWGLARPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPL
APGQVFLVEIEEKELGWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHN
RVPREGRPEAEAAAPRRPPTLLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNV
LPPTARRSRLGVLFCPRPDGTADMHIIINGEDMGPSARGLPAAQPLYAVVDVFASTKSVR
LVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKDFCKYE
Download sequence
Identical sequences G3RIM8
XP_004062331.1.27298 ENSGGOP00000015538 ENSGGOP00000015538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]