SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015554 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015554
Domain Number 1 Region: 89-312
Classification Level Classification E-value
Superfamily C-type lectin-like 5.46e-83
Family Sulfatase-modifying factor-like 0.000000000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015554   Gene: ENSGGOG00000015942   Transcript: ENSGGOT00000015999
Sequence length 318
Comment pep:known_by_projection chromosome:gorGor3.1:3:4498075:4605880:-1 gene:ENSGGOG00000015942 transcript:ENSGGOT00000015999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPALGLVCGRCPELGLVLLLLLLSLLCGAAGSEEAGTGAGAGSLAGSCGCGTPQRPGA
HGSSAAAHRYLXEANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVT
IDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWW
LPVKGANWRHPEGPDSTILHRLDHPVLHVSWNDAVAYCTWAGKRLPTEAEWEYSCRGGLH
NRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWE
WTSDWWAVHHSAEETLNP
Download sequence
Identical sequences ENSGGOP00000015554 ENSGGOP00000015554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]