SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015590 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015590
Domain Number 1 Region: 1024-1043,1147-1370
Classification Level Classification E-value
Superfamily HAD-like 1.28e-55
Family Meta-cation ATPase, catalytic domain P 0.00012
Further Details:      
 
Domain Number 2 Region: 817-903
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.58e-23
Family Calcium ATPase, transduction domain A 0.0032
Further Details:      
 
Domain Number 3 Region: 356-428
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.44e-21
Family HMA, heavy metal-associated domain 0.00023
Further Details:      
 
Domain Number 4 Region: 566-635
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 8.12e-19
Family HMA, heavy metal-associated domain 0.00096
Further Details:      
 
Domain Number 5 Region: 140-210
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 1.57e-18
Family HMA, heavy metal-associated domain 0.00012
Further Details:      
 
Domain Number 6 Region: 488-557
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 2.36e-18
Family HMA, heavy metal-associated domain 0.00083
Further Details:      
 
Domain Number 7 Region: 253-318
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 3.01e-16
Family HMA, heavy metal-associated domain 0.0007
Further Details:      
 
Domain Number 8 Region: 55-126
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 6.54e-16
Family HMA, heavy metal-associated domain 0.00079
Further Details:      
 
Domain Number 9 Region: 767-801,904-1016
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000131
Family Calcium ATPase, transmembrane domain M 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015590   Gene: ENSGGOG00000015975   Transcript: ENSGGOT00000016038
Sequence length 1465
Comment pep:known_by_projection chromosome:gorGor3.1:13:34228935:34302363:-1 gene:ENSGGOG00000015975 transcript:ENSGGOT00000016038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQERQMTAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATS
TVRILGMTCQSCVKSIEDRISNLKGIVSMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMG
FEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSN
QEAVITYQPYLIQPEDLRDHVNGMGFEAAIKNKVAPLSLGPIDIERLQSTNPKRPLSSAN
QNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVQ
YDPSCTSPVALQRAIEALPPGNFKVYLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCST
TLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDM
GFEASVVSESCSTNPLGSHSAGNSMVQTTGGTPTSVQEVAPHAGRFPANHAPDILAKSPQ
STRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEVKYDPEVIQPL
EIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA
TSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSLVF
GIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYK
SLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWL
EHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFP
VDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV
KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQKYFPNPNKH
ISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK
IKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK
EELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAA
PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ
EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK
KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRR
IRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPD
LERYEAQAHGHMKPLTASQVSVHIGMDDRRRDSPRATPWDQVSYVSQVSLSSLTSDKPSR
HSAAADDGGDKWSLLLNGRDEEQYI
Download sequence
Identical sequences G3RTU5
XP_004054587.1.27298 ENSGGOP00000015590 ENSGGOP00000019222 ENSGGOP00000015590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]