SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015615 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015615
Domain Number 1 Region: 185-487
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.73e-96
Family Papain-like 0.00000000153
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015615
Domain Number - Region: 31-113
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.000244
Family Cystatins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015615   Gene: ENSGGOG00000016007   Transcript: ENSGGOT00000016063
Sequence length 489
Comment pep:known_by_projection chromosome:gorGor3.1:11:63455333:63460453:-1 gene:ENSGGOG00000016007 transcript:ENSGGOT00000016063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWLQLLSLLGLLPGAVAAPAQPRAASFQAWGPPSPELLAPARFALEMFNRGRAAGTRA
VLGLVRGRVRQAGQGSLYSLEATLEEPPCNDPMVCRLPVSKKTLLCSFEVLIELGRHVLL
RRDCGPVDTKVPGAGRAQGCEPKSAFTQGSAMISSLSQPHPDNRNETFSSVISLLNEDPL
PQDLPVKMASIFKNFVITYNRTYESKEEARWRLSVFVNNMVRAQKIQALDRGTAQYGVTK
FSDLTEEEFRTIYLNSLLREEPGNKMKQAKSVGDLAPPEWDWRSKGAVTKVKDQGMCGSC
WAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETED
DYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHG
ISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVN
TMASSAVVD
Download sequence
Identical sequences ENSGGOP00000015615 ENSGGOP00000015615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]