SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015625 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015625
Domain Number 1 Region: 217-317
Classification Level Classification E-value
Superfamily EF-hand 2.04e-29
Family Eps15 homology domain (EH domain) 0.00000244
Further Details:      
 
Domain Number 2 Region: 28-121
Classification Level Classification E-value
Superfamily EF-hand 0.000000435
Family Eps15 homology domain (EH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015625
Domain Number - Region: 548-604
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015625   Gene: ENSGGOG00000016013   Transcript: ENSGGOT00000016073
Sequence length 609
Comment pep:known_by_projection chromosome:gorGor3.1:X:16929475:17134367:1 gene:ENSGGOG00000016013 transcript:ENSGGOT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGAAAAAAAAAAAGGGCGSGPPPLLLSEGEQQCYSELFARCAGAAGGGPGSGPPEAA
RVAPGTATAAAGPVADLFRASQLPAETLHQITELCGAKRVGYFGPTQFYIALKLIAAAQS
GLPVRIESIKCQETQSPTMSPLASPPSSPPHYQRVPLSHGYSKLRSSAEQMHPAPYEARQ
PLVQPEGSSSGGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITEEQREYYVNQFR
SLQPDPSSFISGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARK
NGYPLPEGLPPTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMA
DLPVPTQDVTSDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAM
KRGEDPPTPPPRPQKTHSRASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVS
EAELLPQLSRAPSQAAESSPAKKDVLYSQPPSKPIRRKFRPENQAAENQEPSTAASGPAS
AATMKPHPTVQKQSSKQKKAIQTAIRKNKEANAVLARLNSELQQQLKEVHQERIALENQL
EQLRPVTVL
Download sequence
Identical sequences G3RIV8
ENSGGOP00000015625 ENSGGOP00000015625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]