SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015637 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015637
Domain Number 1 Region: 317-626
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.93e-121
Family Mammalian PLC 0.000000281
Further Details:      
 
Domain Number 2 Region: 157-316
Classification Level Classification E-value
Superfamily EF-hand 3.34e-42
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 646-771
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-30
Family PLC-like (P variant) 0.00029
Further Details:      
 
Domain Number 4 Region: 28-141
Classification Level Classification E-value
Superfamily PH domain-like 2.42e-29
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015637   Gene: ENSGGOG00000016029   Transcript: ENSGGOT00000016085
Sequence length 1018
Comment pep:known_by_projection chromosome:gorGor3.1:3:17345126:17571723:1 gene:ENSGGOG00000016029 transcript:ENSGGOT00000016085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGTKQKRERKKTVSFSSMPTEKKISSASDCINSMVEGSELKKVRSNSRIYHRYFLLDADM
QSLRWEPSKKDSEKAKIDIKSIKEVRTGKNTDIFRSNGISDQISEDCAFSVIYGENYESL
DLVANSADVANIWVTGLRYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGHITL
CNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIEVFHELCTRPEIYFLLV
QFSSNKEFLDTKDLMMFLEAEQGVAHINEEISLEIIHKYEPSKEGREKGCLSIDGFTNYL
MSPDCYIFDPEHKKVCQDMKQPLSHYFINSSHNTYLIEDQFRGPSDITGYIRALKMGCRS
VELDVWDGPDNEPVIYTGHTMTSQIVFRSVIDIINKYAFFASEYPLILCLENHCSIKQQK
VMVQHMKKLLGDKLYTTSPNVEESYLPSPDVLKGKILIKAKKLSSNCSGVEGDVTDEDEG
AEMSQRMGKENMEQPNNVPVKRFQLCKELSELVSICKSVQFKEFQVSFQVQKYWEVCSFN
EVLASKYANENPGDFVNYNKRFLARVFPSPMRIDSSNMNPQDFWKCGCQIVAMNFQTPGL
MMDLNIGWFRQNGNCGYVLRPAIMREEVSFFSANTKDSVPGVSPQLLHIKIISGQNFPKP
KGSGAKGDVVDPYVYVEIHGIPADCAEQRTKTVHQNGDAPIFDESFEFQINLPELAMVRF
VVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKP
HKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCG
LSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQ
SLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKG
QADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE
Download sequence
Identical sequences ENSGGOP00000015637 ENSGGOP00000015637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]