SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015641 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015641
Domain Number 1 Region: 481-786
Classification Level Classification E-value
Superfamily Folate-binding domain 2.2e-73
Family Aminomethyltransferase folate-binding domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 67-288,388-473
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.29e-57
Family FAD-linked reductases, N-terminal domain 0.00007
Further Details:      
 
Domain Number 3 Region: 288-387
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.02e-28
Family L-aminoacid/polyamine oxidase 0.0066
Further Details:      
 
Domain Number 4 Region: 829-914
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000000000119
Family Aminomethyltransferase beta-barrel domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015641   Gene: ENSGGOG00000016030   Transcript: ENSGGOT00000016089
Sequence length 916
Comment pep:known_by_projection chromosome:gorGor3.1:9:117297346:117369181:-1 gene:ENSGGOG00000016030 transcript:ENSGGOT00000016089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSRALRVAAAHPRQSPTWGMGPCNLSSAAGPTAEKSVPYQRTLKEGQGTSVVAQGPS
RPLPSTANVVVIGGGSLGCQTLYHLAKLGMSGAVLLERERLTSGTTWHTAGLLWQLRPSD
VEVELLAHTRRVVSRELEEETGLHTGWIQNGGLFIASNRQRLDEYKRLMSLGKAYGVESH
VLSPAETKTLYPLMNVDDLYGTLYVPHDGTMDPAGTCTTLARAASARGAQVIENCPVTSI
RVWTDDFGVRRVAGVETQHGSIQTPCVVNCAGVWASAVGRMAGVKVPLVAMHHAYVVTER
IEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFSLFDLDWEVFTQH
IEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGGC
GQELAHWIIHGRPEKDMHGYDIRRFHHSLTDHPRWIRERSHESYAKNYSVVFPHDEPLAG
RNMRRDPLHEELLGQGCVFQERHGWERPGWFHPQGPAPVLEYDYYGAYGSRAHEDYAYRR
LLADEYTFAFPPHHDTIKKECLACRGAAAVFDMSYFGKFYLVGLDARKAADWLFSADVSR
PPGSTVYTCMLNHRGGTESDLTVSRLAPSHQASPLAPAFEGDGYYLAVGGAVAQHNWSHI
TTVLQDQKFQCQLIDSSEDLGMISIQGPASRAILQEVLDADLSNEAFPFSTHKLLRAAGH
LVRAMRLSFVGELGWELHIPKASCVPVYRAVMAAGAKHGLINAGYRAIDSLSIEKGSQHA
GIQTRPVFLEPSKGVGFSVRLRNSCPAPRLWTVAVPGQTQRRCWQWSHRDKVPMFGLEAI
WRNGQVVGHVRRADFGFAIDKTIAYGYIHDPSGGPVSLDFVKSGDYALERMGVTYGARAH
LKSPFDPNNKRVKGIY
Download sequence
Identical sequences ENSGGOP00000015641 ENSGGOP00000015641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]