SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015649
Domain Number 1 Region: 39-66,185-374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.66e-61
Family G proteins 0.0000000161
Further Details:      
 
Domain Number 2 Region: 70-191
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 1.07e-35
Family Transducin (alpha subunit), insertion domain 0.00000584
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015649   Gene: ENSGGOG00000016040   Transcript: ENSGGOT00000016098
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:18:11971784:12104033:1 gene:ENSGGOG00000016040 transcript:ENSGGOT00000016098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRRMHLKQYELL
Download sequence
Identical sequences ENSGGOP00000015649 ENSGGOP00000015649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]