SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015674 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000015674
Domain Number - Region: 5-52,283-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0366
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015674   Gene: ENSGGOG00000016071   Transcript: ENSGGOT00000016123
Sequence length 431
Comment pep:known_by_projection chromosome:gorGor3.1:9:120349450:120361656:1 gene:ENSGGOG00000016071 transcript:ENSGGOT00000016123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRRRLAHLVLFCPFSKGLQGRLPGLRVRCIFLAWLGVFAGSWLVYVHYSSYSERCRGH
VCQVVICDQYRKGIISGSVCQDLCELHMVEWRTCLSVAPGQQVYSGLWRDKDVTIKCGIE
ETLDSKARSDAAPRRELVLFDKPTRGTSIKEFREMTLSFLKANLGDLPSLPALVGQVLLM
ADFNKDNRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGVPHGAWH
AAALPPLLRPLLPSALQGALQQWLGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTL
ANVGYTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGRDCRAPCDRLMRQCKGD
LIQPNLAKVCALLRGYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTL
LWKKISNTKYS
Download sequence
Identical sequences G3RJ05
XP_004048941.1.27298 ENSGGOP00000015674 ENSGGOP00000015674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]