SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015707 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015707
Domain Number 1 Region: 285-565
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-70
Family Tandem AAA-ATPase domain 0.0000721
Further Details:      
 
Domain Number 2 Region: 53-108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015707   Gene: ENSGGOG00000016092   Transcript: ENSGGOT00000016158
Sequence length 616
Comment pep:known_by_projection chromosome:gorGor3.1:6:73163635:73185651:1 gene:ENSGGOG00000016092 transcript:ENSGGOT00000016158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHGGAPKASTWVVASRRSSTVSRAPERRPAEELNRRGPEGYSVGRGSRWSRGGSKIKN
IQSTTNTTIQIIQEQPESLVKIFGSKAMQTKAKAVIDSFVKKLEENYNSECGVDTAFQPS
VGKDGSTDNNVVSGDRPLIDWDQIREEGLKWQKTKWADLPPIKKNFYKESTATSAMSKVE
ADSWRKENFNITWDDLKDGEKRPIPNPTCTFDDAFQCYPEVVENIKKAGFQKPTPIQSQA
WPIVLQGIDLIGVAQTGTGKTLCYLMPGFIHLVLQPSLKGQRNRPGMLVLTPTRELALQV
EGECCKYSYKGLRSVCVYGGGNRDEQIEELKKGVDIIIATPGRLNDLQMSNFVNLKNITY
LVLDEADKMLDMGFEPQIMKILLDVRPDRQTVMTSATWPHSVHRLAQSYLKEPMIVYVGT
LDLVAVSSVKQNIIVTTEEEKWSHMQTFLQNMSSTDKVIVFVSRKAVADHLSSDLILGNI
SVESLHGDREQRDREKALENFKTGKVRILIATDLASRGLDVHDVTHVYNFDFPRNIEEYV
HRIGRTGRAGRTGVSITTLTRNDWRVASELINILERANQSIPEELVSMAERFKAHQQKRE
MERKMERPQGRPKKFH
Download sequence
Identical sequences ENSGGOP00000015707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]