SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015723 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015723
Domain Number 1 Region: 68-113
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015723   Gene: ENSGGOG00000016121   Transcript: ENSGGOT00000016174
Sequence length 155
Comment pep:known_by_projection chromosome:gorGor3.1:20:28880192:28881402:1 gene:ENSGGOG00000016121 transcript:ENSGGOT00000016174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Download sequence
Identical sequences G3RJ48 H2RDX7 P41134
ENSP00000365273 ENSPTRP00000059507 9598.ENSPTRP00000059507 9606.ENSP00000365280 ENSP00000365280 gi|31317299|ref|NP_002156.2| NP_002156.2.87134 NP_002156.2.92137 XP_001152873.1.37143 XP_004061997.1.27298 XP_016802578.1.37143 GO.78733 HR3123 ENSPTRP00000059507 ENSGGOP00000015723 ENSP00000365280 ENSGGOP00000015723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]