SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015724 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015724
Domain Number 1 Region: 896-1008
Classification Level Classification E-value
Superfamily SEA domain 7.06e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 244-338
Classification Level Classification E-value
Superfamily SEA domain 0.000000000157
Family SEA domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015724
Domain Number - Region: 1056-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015724   Gene: ENSGGOG00000016107   Transcript: ENSGGOT00000016175
Sequence length 1240
Comment pep:known_by_projection chromosome:gorGor3.1:3:100188971:100304734:-1 gene:ENSGGOG00000016107 transcript:ENSGGOT00000016175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLGILIFFLIEGDFPSLTAQTYLSIEEIQEPKSAVSFLLPEESTDLSLAT
KKKQPLDRRETERQWLIRTRRSILFPNGVKICPDESVAEAVANHVKYFKVRVCQEAVWEA
FRTFWDRLPGREEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETVSSSE
LSSPVPVGDTSTLGDTTLSVPHPGVDAYEGASESSLERPEESISNEIENVIEEATKPAGE
QIAEFSIHLLGKQYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKE
NDSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIAE
TLQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATPSSILDNTFQAA
WPSADESITSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVLE
VSSLTLHSVTPAVLQTGLPVASEERTSGSHLVENGLANVEESEDFLSIDSLPSSSFTQPV
PKETITSMEDSDVSLTSSPYLTSSIPFGLDSTSKVKDQLKVSPFLPDASMEKELIFDSGL
GSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDEKLVLVDKMDSTDQI
SKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKAP
LILTSVAISASTDKSDQADAILREDMEQITESSNYEWFDSEVSMVKPDMQTLWTILPESE
RVWTRTSSLEKLSRDILASTPQSAERLWLSVTQSTKLPPTTISTLLEDEVIMGVQDISLE
LDRIGTDYYQPEQVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSGALVV
FFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSIVV
NSRMKFANSVPPNVNNAVYMILEDFCTTAYNTMNLAIDKYSLDVESGDEANPCKFQACNE
FSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAICRCRV
GENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERESPFS
GSSRQPDSLSSIENAVKYNPVYESHRAGCEKYEGPYPQHPFYSSASGDTIGGLSREEIKQ
MYESSELSREEIQERMRVLELYANDPEFAAFVREQQVEEV
Download sequence
Identical sequences ENSGGOP00000015724 ENSGGOP00000026783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]