SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015731 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015731
Domain Number 1 Region: 265-574
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.44e-116
Family Transglutaminase core 0.0000000184
Further Details:      
 
Domain Number 2 Region: 99-260
Classification Level Classification E-value
Superfamily E set domains 2.69e-44
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 588-699
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.01e-29
Family Transglutaminase, two C-terminal domains 0.00049
Further Details:      
 
Domain Number 4 Region: 700-752
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000000000811
Family Transglutaminase, two C-terminal domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015731   Gene: ENSGGOG00000016125   Transcript: ENSGGOT00000016182
Sequence length 753
Comment pep:known_by_projection chromosome:gorGor3.1:14:5202479:5211532:-1 gene:ENSGGOG00000016125 transcript:ENSGGOT00000016182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTLLPGMMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGGRSFWARCCGCCS
CRHAADDDWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVV
NGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNN
PEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGE
FQLPFDPRNEIYIIFNPWCPGDTEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWN
YGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRG
TNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDT
SLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGI
FCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVT
KAIGSNMREDITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAV
MGQDLMVSVMLTNHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMP
VAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEV
QIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVG
Download sequence
Identical sequences ENSGGOP00000015731 ENSGGOP00000015731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]