SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015732 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015732
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-62
Family Calnexin/calreticulin 0.0000552
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.67e-46
Family P-domain of calnexin/calreticulin 0.000000604
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015732
Domain Number - Region: 310-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0807
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015732   Gene: ENSGGOG00000016129   Transcript: ENSGGOT00000016183
Sequence length 417
Comment pep:known_by_projection chromosome:gorGor3.1:19:13189062:13341650:1 gene:ENSGGOG00000016129 transcript:ENSGGOT00000016183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSSSFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPSQAKDEL
Download sequence
Identical sequences G3RJ55
ENSGGOP00000015732 ENSGGOP00000015732 XP_004060167.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]