SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015734 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015734
Domain Number 1 Region: 149-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.64e-125
Family Transglutaminase core 0.00000000395
Further Details:      
 
Domain Number 2 Region: 10-147
Classification Level Classification E-value
Superfamily E set domains 7.35e-44
Family Transglutaminase N-terminal domain 0.0000795
Further Details:      
 
Domain Number 3 Region: 500-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.28e-25
Family Transglutaminase, two C-terminal domains 0.0003
Further Details:      
 
Domain Number 4 Region: 614-709
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-24
Family Transglutaminase, two C-terminal domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015734   Gene: ENSGGOG00000016126   Transcript: ENSGGOT00000016185
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:20:2329433:2367779:1 gene:ENSGGOG00000016126 transcript:ENSGGOT00000016185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISLSSPHLGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEEIL
IFTVETGPRASEALHTKAVFQTSELERGEGWTAAREAQMENTLTVSLASPPSAVVGRYLL
SIRLSSHRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRA
QGWNYGQFEEGILNICLSILDRSPGHQNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVV
QGQWQGKYGGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRV
VSNFNSAHDTDQNLSVDKYVDSFGRTLEDMTEDSMWNFHVWNESWFARQDLGPSYNGWQV
LDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVY
SNTKKIGRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEASGRRTWIR
RAGGRCLWRDDLLEPATKPSIAGKFKVLEPPMLGRDLRLALCLANLTSRAQRMRVNLSGA
TILYTRKPVAEILHESHAVRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGE
KLLVEKDITLEDFITIKVLGPAMVGVAVTVEVTVVNPLLERVKDCALMVEGSGLLQEQLS
IDVPTLEPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Download sequence
Identical sequences ENSGGOP00000015734 ENSGGOP00000015734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]