SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015792 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015792
Domain Number 1 Region: 58-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000095
Family Eukaryotic type KH-domain (KH-domain type I) 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015792
Domain Number - Region: 460-544
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0659
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015792   Gene: ENSGGOG00000016189   Transcript: ENSGGOT00000016243
Sequence length 678
Comment pep:known_by_projection chromosome:gorGor3.1:14:5389562:5400968:1 gene:ENSGGOG00000016189 transcript:ENSGGOT00000016243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTWGARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPK
ENASRAKEYLKGLCSPELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPGAPGSLM
ISGLTEAFVMAQSRVEELAERLSWDFTPGPSSGASQCTGVLRDFSALLQSPGDAHREALL
QLPLAVQEELLSLVQEASSGQGPGALASWEGRSSGLLGAQCQGVRAPPSDGRESLDTGSM
GPGDSRGARGDTYAVEKEGGKQGGPREVDLGWKELPGEEAWEREVALRPQSVGGGARESA
PLKGKALGKEEITLGGGGFYVHREPPGAHGSCHRAAQSRGASLLQRLHNGNASPPRVPSP
PPAPEPPWHCGDRGDCGDRGDVGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEAL
QDPFTLCLANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVF
VPQWRFSKDAKVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIV
SNDQFRDLAEESEKWMAIIRERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGS
SKAQHPSRGFAEHGKQQQGREEEKGSGGIRKTRETERLRRQLLEVFWGQDHKVDFILQRE
PYCRDINQLSEALLSLNF
Download sequence
Identical sequences G3RJA9
ENSGGOP00000015792 XP_004055072.1.27298 ENSGGOP00000015792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]