SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015802 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015802
Domain Number 1 Region: 396-501
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-32
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000227
Family SH3-domain 0.0000952
Further Details:      
 
Domain Number 3 Region: 155-210
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000162
Family SH2 domain 0.0000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015802   Gene: ENSGGOG00000016197   Transcript: ENSGGOT00000016254
Sequence length 511
Comment pep:novel chromosome:gorGor3.1:19:18532336:18546059:1 gene:ENSGGOG00000016197 transcript:ENSGGOT00000016254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESHYRPELPAPKGGNNKLIKVFHRDGHYGFSEPLTFCS
VVDLINHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKS
REYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKE
MQRILLNSERLKSRIAEIHESRTKLEQQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQY
LVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWYVGKINRTQAEEMLS
GKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQ
HASLVQHNDALTVTLAHPVRAPGPGPPPAAR
Download sequence
Identical sequences ENSGGOP00000015802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]