SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015803 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015803
Domain Number 1 Region: 353-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 2 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000244
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 3 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 4 Region: 456-490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000482
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015803
Domain Number - Region: 24-65,104-166
Classification Level Classification E-value
Superfamily Sialidases 0.000196
Family Sialidases (neuraminidases) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015803   Gene: ENSGGOG00000016200   Transcript: ENSGGOT00000016255
Sequence length 519
Comment pep:known_by_projection chromosome:gorGor3.1:9:115763880:115839738:1 gene:ENSGGOG00000016200 transcript:ENSGGOT00000016255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLLALFLHCLPLASGDYDICKSWVTTDEGPTWEFYACQPKVMRLKDYVKVKVEPSGIT
CGDPPERFCSHENPYLCSNECDASNPDLAHPPRLMFDKEEEGLATYWQSITWSRYPSPLE
ANITLSWNKTVELTDDVVMTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSAR
RARDMSSSSAHRVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRLESA
KGLKEFFTLTDLRMRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSMRE
GSLQCECEHNTTGPDCGKCKKNFRTRSWRAGSYLPLPHGSPNACAAAGSFGNCECYGHSN
RCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSVHDR
CNETGFCECREGAAGPKCDDCLPTHYWRQGCYPNVCDDDQLLCQNGGTCLQNQRCACPRG
FTGVRCEQPRCDPADDDGGLDCALLGCLLLLGLAARLGR
Download sequence
Identical sequences ENSGGOP00000015803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]