SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015809 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015809
Domain Number 1 Region: 40-87,280-453
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000000267
Family YVTN repeat 0.047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015809
Domain Number - Region: 74-197
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0356
Family Extended AAA-ATPase domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015809   Gene: ENSGGOG00000016209   Transcript: ENSGGOT00000016261
Sequence length 467
Comment pep:known_by_projection chromosome:gorGor3.1:9:118721455:118776754:1 gene:ENSGGOG00000016209 transcript:ENSGGOT00000016261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRWRWQRDMHPARKLLSLLFLILMGTELTQVLPTNPEESWQVYSSAQDSEGRCICTVV
APQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQ
VEESHKQHLARQFKAIKAKMDELRPLIPVLEEYKADAKLVLQFKEEVQNLTSVLNELQEE
IGAYDYDELQSRVSNLEERLRACMQKLACGKLTGISDPVTVKTSGSRFGSWMTDPLAPEG
DNRVWYMDGYHNNRFVREYKSMVDFMNTDNFTSHRLPHPWSGTGQVVYNGSIYFNKFQSH
IIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVDESGLWAVYATNQNAGNIV
VSRLDPVSLQTLQTWNTSYPKRSAGEAFIICGTLYVTNGYSGGTKVHYAYQTNASTYEYI
DIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVIRSDEL
Download sequence
Identical sequences A0A2J8UIQ3 A0A2K6N6N8 A0A2K6Q7Y5 G3RJC5 K7CNL5 Q6IMJ8
NYSGRC-17136143 ENSGGOP00000015809 ENSP00000252854 ENSP00000252854 NP_055094.1.87134 NP_055094.1.92137 XP_004048887.1.27298 9606.ENSP00000252854 ENSGGOP00000015809 gi|17136143|ref|NP_055094.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]