SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015810 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015810
Domain Number 1 Region: 54-108,213-313
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-42
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 2 Region: 6-75,106-159
Classification Level Classification E-value
Superfamily EF-hand 0.000000013
Family Calmodulin-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015810   Gene: ENSGGOG00000016204   Transcript: ENSGGOT00000016262
Sequence length 583
Comment pep:known_by_projection chromosome:gorGor3.1:6:36283030:36306275:1 gene:ENSGGOG00000016204 transcript:ENSGGOT00000016262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFR
LWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLS
VWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQL
QPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQR
QEWTAAIQMAIRLQAEGKTSLHKDLAERLLQEEEERRRSQHRELQQALEGQLREAEQARA
SMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRLAQTRLLEEEEE
KLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEA
AQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLARRDSSLKRLTRW
GSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN
Download sequence
Identical sequences ENSGGOP00000015810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]