SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015815 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015815
Domain Number 1 Region: 773-1524
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.64e-258
Family Motor proteins 0.000000000231
Further Details:      
 
Domain Number 2 Region: 2882-2991
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000275
Family Second domain of FERM 0.0087
Further Details:      
 
Domain Number 3 Region: 2445-2528
Classification Level Classification E-value
Superfamily SH3-domain 0.000000101
Family SH3-domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015815
Domain Number - Region: 2992-3042
Classification Level Classification E-value
Superfamily PH domain-like 0.00334
Family Third domain of FERM 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015815   Gene: ENSGGOG00000016179   Transcript: ENSGGOT00000016267
Sequence length 3107
Comment pep:known_by_projection chromosome:gorGor3.1:5:61441443:61501543:-1 gene:ENSGGOG00000016179 transcript:ENSGGOT00000016267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKRSLKGTSRLFMGFRDRTPKISKKGQFRSASAFFWGLHTGPQKTKRKKKARTVLKSTSK
LMTQMRMGKKKRAMKGKKPSFMVIRFPGRRGYGRLRPRARSLSKASTAINWLTKKFLLKK
AEESGSKQATVDAWLQRSSSRMGSRKLPFPSGAEILRPGGRLRRFPRSRSIYASGEPLGF
LPFEDEAPFHHSGSRKSLYGLEGFQDLGEYYDYHRDGDDYYDRQSLHRYEEQEPYLAGLG
PYSLAWPPYGDHYYGYPPEDPYDYYHPDYYGGPFDPGYTYGYGYDDYEPTYAPLSGYSSP
YSYHDGYEGEAHPYGYYLDPYAPYDAPYPPYDLPYHTPYDVPYFDPYGVHYTVPYAEGVY
GGGDEAIYPPEVPYFYPEEWASAFVYPWVPPPIPSPHNPYAHAMDDIAELEEPEDAGAER
QGTSFRLPSAAFFEQQGMDKPARSKLSLIRKFRLFPRPQVKLFGKEKLEVPLPPSLDIPL
PLGDADEEEDEEELPPVSAVPYGHPFWGFLTPRQRNLQRALSAFGAHRGLGFGPEFGRPV
PRPATSLARFLKKTLSEKKPIARLRGSQKAQAGGPAVREAAYKRFGYKLAGMDPEKPGTP
IVLRRAQPRARCSDVTAPKDVLPEQKTLRPSLSYPLAACDQTRATWPPWHRWGTLPQAAA
PLAPIRAPEPLPKAGERRQAAPGRFAVVMPRVQKLSSFQRVGPATLKPRVQPTQDPKPRA
CSLRCSCLWLRADAYGPWPRVHTHPQSCHLGPGAACLSLRGSWEEVGPTSWRNKMHSIRN
LPSMRFREQHREDGVEDMTQLEDLQETTVLSNLKIRFERNLIYTYIGSILVSVNPYQMFG
IYGPEQVQQYNGRALGENPPHLFAVANLAFAKMLDAKQNQCIIISGESGSGKTEATKLIL
RYLAAMNQKREVMQQIKILEATPLLESFGNAKTVRNDNSSRFGKFVEIFLEGGVISGAIT
SQYLLEKSRIVFQAKNERNYHIFYELLAGLPAQLRQAFSLQEAETYYYLNQGGNCEIAGK
SDADDFRRLLAAMEVLGFSSEDQDSIFRILASILHLGNVYFEKYETDAQEVASVVSAREI
QAVAELLQISPEGLQKAITFKVTETMREKIFTPLTVESAVDARDAIAKVLYALLFSWLIT
RVNALVSPRQDTLSIAILDIYGFEDLSFNSFEQLCINYANENLQYLFNKIVFQEEQEEYI
REQIDWQEITFADNQPCINLISLKPYGILRILGLQCLDCPQATDHTFLQKCHYHHGANPL
YSKPKMPLPEFTIKHYAGKVTYQVHKFLDKNHDQVRQDVLDLFIRSRTRVVAHLFSSHAP
QAAPQRLGKSSSVTRLYKAHTVAAKFQQSLLDLVEKMERCNPLFMRCLKPNHKKEPGLFE
PDVVMAQLRYSGVLETVRIRKEGFPVRLPFQGFIDRYCCLVALKHDLPANGDMCVSVLSR
LCKVMPNMYRVGVSKLFLKEHLYQLLESMREHVLNLAALTLQRCLRGFFIKRRFRSLRHK
IILLQSRARGYLARQRYQQMRRSLVKFRSLVHAYVSRRRYLKLRAEWRRQVEGALLWEQE
ELSKREVVAVGHLEVPAELAGLLQAVAGLGLARVPQVAPVRTPRLQAEPRVTLPLDINNY
PMAKFVQCHFKEPAFGMLTVPLRTPLTQLPAEHHAEAVSIFKLVWAIFLAKKKKNSALEP
LTRVRLASEALITDPELRFHPKAPREPRIWQHAANGHHLASLVTLWQLTAGLASEFPTPT
PQPSAPRFVSDYGRNGFQAVCQHRLMQAMGRAQQQGSGAARTLPPTQLEWTATYEKASMA
LDVGCFNGDQFSCPVHSWSTGEEVAGDILRHRGLADGWRGWTVAMKNGVQWAELAGHDYV
LDLVSDLELIRDFPRQKSYFIVGAEGPAASRGGPKVVFGNSWDSDEDMSTRPQPQEHMPK
VLDSDGYSSHNQDGTNGETEAQRGTATQQESDSLGEPAVPHKGLDCYLDSLFDPVLSYGD
ADLEKPTAIAYRMKGGGQPGGGSSSGTEDAPRRPPEPKPIPGLDASTLALQQAFIHKQAV
LLAREMTLQAMALQQQPLSAALRSLPAEKPPAPEAQPTSVGTGPPAKPVLLRATPKPLAP
APLAKAPRLPIKPVAAPVLAQDQASPETTSPSPELVRYSTLNSEHFPQPTQQIKNIVRQY
QQPFRGGRPEALRKDGGKVFMKRPDPHEEALMILKGQMTHLAAAPGTQVSREAVALVKPV
TSAPRPSMAPTSALPSRSLEPPEELMQTRLHRLINPNFYGYQDAPWKIFLRKEVFYPKDS
YSHPVQLDLLFRQILHDTLSEACLRISEDERLRMKALFAQNQLDTQRPLVTESVKRAVVS
SARDTWEVYFSRIFPATGSVGTGVQLLAVSHVGIKLLRMVKGGQEAGGQLQVLRAYSFAD
ILFVTMPSQNMLEFNLASEKVILFSARAHQVKTLVDDFILELKKDSDYVVAVRNFLPEDP
ALLAFHKGDIIHLQPLEPPRVGYSAGCVVRRKVVYLEELRRRGPDFGWRFGTIHGRVGRF
PSELVQPAAAPDFLQLPAEPGRGRAAAVAAAVASAAAAQEVGRRREGPPVRARSADHGED
ALALPPYTMLEFAQKYFRDPQRRPQDGLRLKSKEPRESRTLEDMLCFTKTPLQESLIELS
DSSLSKMATDMFLAVMRFMGDAPLKGQSDLDVLCNLLKLCGDHEVMRDECYCQVVKQITD
NTSSKQDSCQRGWRLLYIVTAYHSCSEVLHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQ
KTLRFGGRLELPSSIELWAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEM
ALTRPEAFNEYVIFVVTNRGQHVCPLSRRAYILDVASEMEQVDGGYMLWFRRVLWDQPLK
FENELYVTMHYNQVLPDYLKGLFSSVPASRPSEQLLQQVSKLASLQHRAKDHFYLPSVRE
VQEYIPAQLYRTMAGSTWLNLVSQHRQQTQALSPHQARAQFLGLLSALPMFGSSFFFIQS
CSNIAVPAPCILAINHNGLNFLSTETHELMVKFPLKEIQSTRTQRPTANSSYPYVEIALG
DVAAQRTLQLQLEQGLELCRVVAVHVENLLSAHEKQLTLPPSEITLL
Download sequence
Identical sequences ENSGGOP00000015815 ENSGGOP00000015815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]