SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015816 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015816
Domain Number 1 Region: 216-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000745
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 283-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015816
Domain Number - Region: 391-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 339-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 40-96
Classification Level Classification E-value
Superfamily Sialidases 0.0167
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015816   Gene: ENSGGOG00000016213   Transcript: ENSGGOT00000016268
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:1:109964377:110321647:1 gene:ENSGGOG00000016213 transcript:ENSGGOT00000016268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQSATWKEYPKPLQVNITLSWSKT
IELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYATDCLDAFHMDPKSVKDLSQHTV
LEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNMASLYGQLDTTKKLRDFFTVTD
LRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCNLHATVCVYDNSKLTCECEHNT
TGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCEPKYSSLQDCECFGHSNRCSYIDLLNT
VICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIECYCNPLGSIHDRCNGSGFCECK
TGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTCHNNVRCLCPAAYTGILCEKLR
CEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Download sequence
Identical sequences ENSGGOP00000015816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]