SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015862 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015862
Domain Number 1 Region: 268-430
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.32e-40
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.01e-28
Family PWWP domain 0.0016
Further Details:      
 
Domain Number 3 Region: 429-551
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 6.01e-28
Family Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015862   Gene: ENSGGOG00000016258   Transcript: ENSGGOT00000016315
Sequence length 553
Comment pep:known_by_projection chromosome:gorGor3.1:16:5055091:5100220:-1 gene:ENSGGOG00000016258 transcript:ENSGGOT00000016315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQL
KPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRP
NSGDEKRKLSLSEGKVKKNMGEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKD
LTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLK
ICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTA
EKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDM
STVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM
GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASI
FLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQS
DNDMSAVYRAYIH
Download sequence
Identical sequences G3RJH1 K7ALH7
ENSGGOP00000015862 ENSGGOP00000019000 ENSGGOP00000015862 ENSP00000322716 gi|40556376|ref|NP_115958.2| NP_115958.2.87134 NP_115958.2.92137 9598.ENSPTRP00000013200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]