SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015868 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015868
Domain Number 1 Region: 194-247,296-393,742-954
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 5.23e-50
Family Calcium ATPase, transmembrane domain M 0.013
Further Details:      
 
Domain Number 2 Region: 534-594,642-728
Classification Level Classification E-value
Superfamily HAD-like 5.34e-27
Family Meta-cation ATPase, catalytic domain P 0.005
Further Details:      
 
Domain Number 3 Region: 442-549
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 7.85e-16
Family Metal cation-transporting ATPase, ATP-binding domain N 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015868
Domain Number - Region: 234-297
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0327
Family Calcium ATPase, transduction domain A 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015868   Gene: ENSGGOG00000016250   Transcript: ENSGGOT00000016321
Sequence length 999
Comment pep:known_by_projection chromosome:gorGor3.1:1:17502374:17532166:-1 gene:ENSGGOG00000016250 transcript:ENSGGOT00000016321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI
PLLLFRWKPLWGVRLRLRPCSLAHAETLVIEIRDKEDSSWKLFTVQVQTEAIGEGSLEPS
PQAQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIETQQ
AFYQVSLLDHGRSCDDIHRSRHGLSLQDQMVRKAIYGPNVISIPVKSYPQLLVDEESIPV
LKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGFCTAKGGLVSSIL
HPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVTVVVPPA
LPAAMTVCTLYSQSRLRRQGIFCIHPLRINLGGKLQLVCFDKVLEEEPAADSAFGTQVLA
VMRPPFWEPQLQAMEEPPVPVSVLHRFPFSSALQRMSVVVAWPGATQPEAYVKGSPELVA
GLCNPETVPTDFAQMLQSYTAAGYRVVALASKPLPTVPSLEAAQQLTRDTVEGELSLLGL
LVMRNLLKPQTTPVIQALRRTRIRAVMVTGDNLQTAVTVARGCGMVAPQEHLIIVHATHP
ERGQPASLEFLPMESPTAVNGIKDPDQAASYAVEPDPRSRHLALSGPTFGIIVKHFPKLL
PKVLVQGTVFARMAPEQKTELVCELQKLQYCVGMCGDGANDCGALKVADVGISLSQAEAS
VVSPFTSSMASIECVPMVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDL
QFLAIDLVITTTVAVLMSRTGPALVLGRVRPPGALLSVPVLSSLLLQVALVTGVQLGGYF
LTLAQPWFVPLNRTVPAPDNLPNYENTVVFSLSSFQYLILAAAVSKGAPFRRPLYTNVPF
LVALALLSSILVGLVLVPGLLQGPLALRNITDTCFKLLLLGLVTFNFVGAFMLESVLDQC
LPACLRHLRPKRASKKRFKQLERELAEQPWPPLPAGPLR
Download sequence
Identical sequences ENSGGOP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]