SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015871 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015871
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000323
Family FHA domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015871   Gene: ENSGGOG00000016268   Transcript: ENSGGOT00000016324
Sequence length 1531
Comment pep:known_by_projection chromosome:gorGor3.1:4:128010126:128101087:1 gene:ENSGGOG00000016268 transcript:ENSGGOT00000016324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLAGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTVVQGEMRVPEEALKHEKFTIQLQL
SQKSSESELSKSASAKSIDSKVADAATEVQHKTTEALKSEEKAMDISAMPRGTPLHGQPS
WWGDDEVDEKRAFKTNGKPEEKNHEAGTSGCSIDAKQVEEQSAAANEEVLFPFCREPSYF
EIPTKEFQQPSQITESTIHEIPTKDTPSSHITGAGHASFTIEFDDSTPGKVTIRDHVTKF
TSDQRHKSKKSSPGTQDLLGIQTGMMAPENKVADWLAQNNPPQMLWERTEEDSKSIKSDV
PVYLKRLKGNKHDDGTQSDSENAGAHRRCSKRATLEEHLRRHHSEHKKLQKVQATEKRQD
QAVTSSAHHRGGHGVPHGKLLKQKSKEPLVSIPFLQTALLRSSGSLGHRPSQEMDKMLKN
QATSATSEKDNDDDQSDKGTYTIESENPNSEEVEARKMIDKVFGVDDNQDYNRPVINEKH
KDLIKDWALSSAAAVMEERKPLTTSGFHHSEVYISSVYLFECIKYKYASVSTKEIRYMKE
ETKLLLEKKIEKETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKV
VTQRSEIGEKQDTELQEKETPTQVYQKDKQDADRPLSKMNRAVNGETLKTGGDNKTLLHL
GSSAPGKEKSETDKETSLVKQTLAKLQQEQREEAQWTPTKLSSKNVSGQTDKCREETFKQ
ESQPPEKNSGHSTSKGDRVAQSESKRRKAEEILKSQTPKGGDKKESSKSLVRQGSFTIEK
PSPNIPIELIPHINKQTSSTPSSLALTSASRIRERSESLDPDSSMDTTLILKDTEAVMAF
LEAKLREDNKTDEGPDTPSYKRDNSISPESDVDTASTISLVTGETERKSTQKQKSFTSLY
KDRCSTGSPSKDVTKSSSSGAREKMEKKTKSRSTDVGSRADGRKFVQSSGRIRQPSVDLT
HDDQTSSVPHSAISDIMSSDQETYSRKPHGRTPLTSADEHVHSKLEGSKVTKSKTSPVVS
GSSSKSTTLPRPRPTRTSLLRRARRGEASDSELADADKASVASEVSTTSSTSKPPTGRCN
ISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPRIRA
NSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPAL
KTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDVAGEI
DSVTSSGTAPSTTVSTAAITPGSAIDTREEVGDLHGEMHKLVDRVFDESLNFRKIPPLVH
SKTPEGNNSRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSID
KTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKTSSMEISSILQELKRVEKQLQAINAM
IDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTLGQPEARALHPAAVSAAA
EFENAESEADFSIHFNRVNPDGEEEDVTVHE
Download sequence
Identical sequences ENSGGOP00000015871 ENSGGOP00000015871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]