SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015950 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015950
Domain Number 1 Region: 1126-1346
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 7.85e-86
Family Fibrinogen C-terminal domain-like 0.000000856
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-24
Family Fibronectin type III 0.0000096
Further Details:      
 
Domain Number 3 Region: 955-1123
Classification Level Classification E-value
Superfamily Fibronectin type III 3.98e-22
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 778-937
Classification Level Classification E-value
Superfamily Fibronectin type III 3.63e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-20
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000107
Family Fibronectin type III 0.00000385
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015950
Domain Number - Region: 300-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.009
Family Integrin beta EGF-like domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015950   Gene: ENSGGOG00000016345   Transcript: ENSGGOT00000016404
Sequence length 1358
Comment pep:known_by_projection chromosome:gorGor3.1:1:154670597:154882100:-1 gene:ENSGGOG00000016345 transcript:ENSGGOT00000016404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADGETVVLKNMLIGVNLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKE
HPVVFNHVYNINVPFDSLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINF
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGN
FSFESCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCICDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGTCLCEEGYVGEDCGQRQCLNA
CSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGL
VGGEGGRTTFRLQPPLSQYSVQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNL
RVGSRTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHEVLVPKGIGPTTRATLTDLVPGT
EYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLI
ATNITPTEALLQWKAPVGEVENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTAT
MYATNGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYVLTYKSTDG
SRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTAWSSITSTAFTTGGRVFPHPQDCAQ
HLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWADYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
Download sequence
Identical sequences G3RJQ4
ENSGGOP00000015950 XP_004027992.1.27298 XP_018882476.1.27298 XP_018882482.1.27298 ENSGGOP00000015950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]