SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015958 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015958
Domain Number 1 Region: 2800-2979
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-36
Family Laminin G-like module 0.00000513
Further Details:      
 
Domain Number 2 Region: 2206-2392
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-34
Family Laminin G-like module 0.00094
Further Details:      
 
Domain Number 3 Region: 2626-2791
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-32
Family Laminin G-like module 0.0000474
Further Details:      
 
Domain Number 4 Region: 2037-2205
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.1e-29
Family Laminin G-like module 0.00087
Further Details:      
 
Domain Number 5 Region: 2389-2584
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.49e-27
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 828-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family Laminin-type module 0.0013
Further Details:      
 
Domain Number 7 Region: 778-830
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 721-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 1023-1071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 10 Region: 249-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000213
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 11 Region: 1440-1490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 1382-1433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 13 Region: 888-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 14 Region: 376-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 15 Region: 433-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 16 Region: 1488-1534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 17 Region: 974-1021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 930-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 19 Region: 306-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 20 Region: 682-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family EGF-type module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015958
Domain Number - Region: 57-135
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00034
Family APC10-like 0.059
Further Details:      
 
Domain Number - Region: 1340-1364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family Laminin-type module 0.055
Further Details:      
 
Domain Number - Region: 1069-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015958   Gene: ENSGGOG00000016323   Transcript: ENSGGOT00000016412
Sequence length 2983
Comment pep:known_by_projection chromosome:gorGor3.1:18:6995723:7139995:-1 gene:ENSGGOG00000016323 transcript:ENSGGOT00000016412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRPVRNPQCRICDGNSANPRERHP
ISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERSL
DGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTSL
INGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHREPKELDPIVTRRYYYSI
KDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQQPWRPGTVSSG
NTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGVCINCLQNTMGINCETCIDGYY
RPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLQNGKRPGQCPCKEGYTGEKCDRC
QLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPRGCS
ECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIPSQQDALGGRRQVSINNTAVMQ
RLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMLHADVIIKGNGLTLST
QAEGLSLQPYEEYLNVVRLVPENFRDFHNKRQIDRDQLMTVLANVTHLLIRANYNSAKMA
LYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSCESCLSGYYRVDGILFGGICQP
CECHGHAAECNVHGVCIACAHNTTGDHCEQCLPGFYGDSSRGTPGDCQPCACPLTIASNN
FSPTCHLNDGDEVVCDRCAPGYSGAWCERCADGYYGNPTVPGESCVPCDCSGNVDPSEAG
HCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCRACECHVKGSHSAVCHLETGLC
DCKPNVTGQQCDQCLHGYYGLDSGHGCQPCNCSVAGSVSDGCTDEGQCHCVPGVAGKRCD
RCARGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHTQGVKCEECEDGHWGYDVEVGC
QACNCSLVGSTHHRCDVVTGHCQCKSKFGGQACDQCSLGYRDFPDCVPCDCDLRGTSGDA
CNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALRADNPLGCSPCFCSGLSHLCSE
LEGYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPDFLLDAATVRQHIRAEPFYWRL
PQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLIKGGRIRKQVIYMDAPAPENGV
RQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLGDVEYILIKASYGQGLQQSRISNISME
VGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGYHRGKLPAGSDRGPRPLVAPCV
PCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYGKVTGSASDCALCACPHSPPAS
FSPTCVLEGDHDFRCDACLLGYEGKHCERCSSGYYGNPQTPGGSCQKCDCNPHGSVHGDC
DRTSGQCVCRLGASGLRCDECELRHILMETDCVSCDDECVGVLLNDLDEIGDAILSLNLT
GIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLEGVAEETDNLQKKLTRMLASTQ
KVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQTLDEDFLLPNSTLQNMQWNGTS
LLEIMQIRDFTQLHQNATLELDKKLHVQEEQNLTSELIVQGRGLIDAAAAQIDAVQDALE
HLEDHQDKLLLWSAKIRHHIDDLVMHMSQRNAVDLVYRAEDHAAEFQRLADVLYSGLENI
RNVSLNATSAAYVHYNIQSLIEESEELARDAHRTVTEMSLLSESLGSNGKAAVQRSSRFL
KEGNNLSRKLPGIALELSELRNKTNRFQENAVEITRQTNESLLILRAIPEGIRDKGAKTK
ELATSASQSAVSTLRDVAGLSQELLNTSASLSRVNTTLLETHQLLQDSTMATLLAGRKVK
DVETQANLLFDRLKPLKMLEENLSRNLSEIKLLISQARKQAASIKVAVSADRDCIRAYQP
QISSTNYNTLTLNVKTQEPDNLLFYLGSSTTSDFLAVEMRRGKVAFLWDLGSGSTRLEFP
DFPIDDNRWHSIHVARFGNIGSLSVKEMSSNQKSPTKTSKSPGTANVLDVNNSTLMFLGG
LGGQIKKSPAVKVTHFKGCLGEAFLNGKSIGLWNYIEREGKCRGCFGSSQNEDPSFHFDG
SGYSVVEKSLPATVTQIIMLFNTFSPNGLLLYLGSYGTKDFLSIELFRGRVKVMTDLGSG
PITLLTDRRYNNGTWYKIAFQRNRKQGVLAVINAYNTSNKETKQGETPGASSDLNRLDKD
PIYVGGLPRSRVVRRGVTTKSFVGCIKNLEISRSTFDLLRNSYGVRKGCLLEPIRSVSFL
KGGYIELPPKSLSPESEWLVTFATTNSSGIILAALGGDVEKRGDREEAHVPFFSIMLIGG
NIEVHVNPGDGTGLRKALLHAPTGTCSDGQAHSISLVRNQRIITVQLDENNPVEMKLGAL
VESRTINVSNLYVGGIPEGEGTSLLTMRRSFHGCIKNLIFNLELLDFNSAVGHEQVDLDT
CWLSERPKLAPDAEDSKLLPEPWAFPEQCVVDAALEYVPGAHQFGLTQNSHFILPFNQSA
VRKKLSVELSIRTFASSGLIYYMAHQNQADYAVLQLHGGRLHFMFDLGKGRTKVSHPALL
SDGKWHTVKTDYVKRKGFITVDGRESPMVTVVGDGTMLDVEGLFYLGGLPSQYQARKLGN
ITHSIPACIGDVTVNSKQLDKDSPVSAFTVNRCYAVAQEGTYFDGSGYAALVKEGYKVQS
DVNITLEFRTSSQNGVLLGISTAKVDAIGLELVDGKVLFHVNNGAGRITAAYEPKTATAL
CDGKWHTLQANKSKHRITLIVDGNAVGAESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRS
QTSFRGCLRKLALIKSPQVQSFDFSRAFELHGVFLHSCPGTES
Download sequence
Identical sequences ENSGGOP00000015958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]