SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015970 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015970
Domain Number 1 Region: 308-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-44
Family SPRY domain 0.00014
Further Details:      
 
Domain Number 2 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 1.51e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000168
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000015970
Domain Number - Region: 146-204
Classification Level Classification E-value
Superfamily STAT 0.00271
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015970   Gene: ENSGGOG00000016366   Transcript: ENSGGOT00000016424
Sequence length 481
Comment pep:known_by_projection chromosome:gorGor3.1:6:31130167:31137132:-1 gene:ENSGGOG00000016366 transcript:ENSGGOT00000016424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAASVTSLADEVNCPICQGTLREPVTIDCGHNFCRACLTRYCEIPGPDLEESPTCPLC
KEPFRPGSFRPNWQLANVVENIERLQLVSTLGLGEEDVCQEHGEKIYFFCEDDEMQLCVV
CREAGEHATHTMRFLEDAAAPYREQIHKCLKCLRKEREEIQEVQSRENKRMQVLLTQVST
KRQQVISEFAHLRKFLEEQQSILLAQLESLDGDILKQRDEFDLLVAGEICRFSALIEELE
EKNERPARELLTDIRSTLIRCETRKCRKPVAVSPELGQRIRDFPQQALPLQREMKMFLEK
LCFELDYEPAHISLDPQTSHPKLLLSEDHQRAQFSYKWQNSPDNPQRFDRATCVLAHTGI
TGGRHTWVVSIDLAHGGSCTMGVVSEDVQRKGELRLRPEEGVWAVRLAWGFVSALGSFPT
RLTLKEQPWQVRVSLDYEVGWVTFTNAVTREPIYTFTASFTRKVIPFFGLWGRGSSFSLS
S
Download sequence
Identical sequences G3RJS4
XP_004043608.1.27298 ENSGGOP00000015970 ENSGGOP00000020887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]