SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016014 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016014
Domain Number 1 Region: 8-250
Classification Level Classification E-value
Superfamily HAD-like 1.07e-55
Family NagD-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016014   Gene: ENSGGOG00000016414   Transcript: ENSGGOT00000016469
Sequence length 259
Comment pep:known_by_projection chromosome:gorGor3.1:18:44737185:44780668:-1 gene:ENSGGOG00000016414 transcript:ENSGGOT00000016469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALKAVLVDLSGTLHTEDAAVPGAQEALKRLRGASVIVRFVTNTTKESKQDLLERL
RKLEFDISEDEIFTSLTAARSLLEQKQVRPMLLVDDRALPDFKGIQTSDPNAVVMGLAPE
HFHYQNLNQAFRLLLDGAPLIAIHKARYYKRKDGLALGPGPFVTALEYATDTKATVVGKP
EKTFFLEALRGTGCEPEEAVMIGDDCRDDVGGAQDVGMLGILVKTGKYRASDEEKINPPP
YLTCESFPHAVDHILQHLL
Download sequence
Identical sequences G3RJW4
ENSGGOP00000016014 XP_018869625.1.27298 XP_018869626.1.27298 ENSGGOP00000016014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]