SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016022 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016022
Domain Number 1 Region: 58-105,145-409,443-588
Classification Level Classification E-value
Superfamily Clc chloride channel 1.7e-127
Family Clc chloride channel 0.00011
Further Details:      
 
Domain Number 2 Region: 596-756
Classification Level Classification E-value
Superfamily CBS-domain pair 1.26e-32
Family CBS-domain pair 0.0000000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016022   Gene: ENSGGOG00000016419   Transcript: ENSGGOT00000016477
Sequence length 761
Comment pep:known_by_projection chromosome:gorGor3.1:X:50761656:50793321:1 gene:ENSGGOG00000016419 transcript:ENSGGOT00000016477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKSYNGGGIGSSNRIMDFLEEPIPGVGTYDDFNTIDWVREKSRDRDRHREITNKSKESTW
ALIHSVSDAFSGWLLMLLIGLLSGSLAGLIDISAHWMTDLKEGICTGGFWFNHEHCCWNS
EHVTFEERDKCPEWNSWSQLIISTDEGAFAYIVNYFMYVLWALLFAFLAVSLVKVFAPYA
CGSGIPEIKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLGKEGPLVHVACCCGNIL
CHCFNKYRKNEAKRREVLSAAAAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAA
LVAAFTLRSINPFGNSRLVLFYVEFHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCR
KRKTTQLGKYPVIEVLVVTAITAILAFPNEYTRMSTSELISELFNDCGLLDSSKLCDYEN
RFNTSKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIA
GRLLGVGMEQLAYYHQEWTVFNSWCSQGADCITPGLYAMVGAAACLGGVTRMTVSLVVIM
FELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFAHKTLAMDV
MKPRRNDPLLTVLTQDSMTVEDVENIISETTYSGFPVVVSRESQRLVGFVLRRDLIISIE
NARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRK
LGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSILFN
Download sequence
Identical sequences ENSGGOP00000016022 ENSGGOP00000016022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]