SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016058 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016058
Domain Number 1 Region: 39-101
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.09e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016058   Gene: ENSGGOG00000016464   Transcript: ENSGGOT00000016515
Sequence length 152
Comment pep:known_by_projection chromosome:gorGor3.1:10:80679146:80679604:-1 gene:ENSGGOG00000016464 transcript:ENSGGOT00000016515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAF
DRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDH
YLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Download sequence
Identical sequences F1T0H4 G3RK03 H2Q1Z1 Q8N100
ENSPTRP00000004403 ENSP00000362777 NP_660161.1.87134 NP_660161.1.92137 XP_004049541.1.27298 XP_521492.2.37143 9598.ENSPTRP00000004403 9606.ENSP00000362777 ENSPTRP00000004403 ENSP00000362777 gi|21553337|ref|NP_660161.1| ENSP00000362777 ENSGGOP00000016058 ENSGGOP00000016058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]