SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016064 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016064
Domain Number 1 Region: 39-263
Classification Level Classification E-value
Superfamily L domain-like 1.12e-35
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 353-566
Classification Level Classification E-value
Superfamily L domain-like 1.25e-35
Family Ngr ectodomain-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016064   Gene: ENSGGOG00000016467   Transcript: ENSGGOT00000016521
Sequence length 845
Comment pep:known_by_projection chromosome:gorGor3.1:X:143620429:143624930:1 gene:ENSGGOG00000016467 transcript:ENSGGOT00000016521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGVWFLSVLTVAGILQTESRKTAKDICKIRCLCEEKENVLNINCENKGFTTVSLLQPP
QYRIYQLFLNGNLLTRLYPNEFVNYSNAVTLHLGNNGLQEIRTGAFSGLKTLKRLHLNNN
KLEILREDTFLGLESLEYLQADYNYISAIEAGAFSKLNKLKVLILNDNLLLSLPSNVFRF
VLLTHLDLRGNRLKVMPFAGVLEHIGGIMEIQLEENPWNCTCDLLPLKAWLDTITVFVGE
IVCETPFRLHGKDVTQLTRQDLCPRKSASDSSQRGSHADTHVQRLSPTMNPALNPTRAPK
ASRPPKMRNRPTPRVTVSKDRQSFGPIMVYQTKSPVPLTCPSSCVCTSQSSDNGLNVNCQ
ERKFTNISDLQPKPTSPKKLYLTGNYLQTVYKNDLLEYSSLDLLHLGNNRIAVIQEGAFT
NLTSLRRLYLNGNYLEVLYPSMFDGLQSLQYLYLEYNVIKEIKPLTFDALINLQLLFLNN
NLLRSLPDNIFGGTALTRLNLRNNHFSHLPVKGVLDQLPAFIQIDLQENPWDCTCDIMGL
KDWTEHANSPVIINEVTCESPAKHAGEILKFLGREAICPDSPNLSDGTILSMNHNTDTPR
SLSVSPSSYPELHTEVPLSVLILGLLVVFILSVCFGAGLFVFVLKRRKGVPSVPRNTNNL
DVSSFQLQYGSYNTETHDKTDGHVYNYIPPPVGQMCQNPIYMQKEGDPVAYYRNLQEFSY
SNLEEKKEEPATPAYTISATELLEKQATPREPELLYQNIAERVKELPSAGLVHYNFCTLP
KRQFAPSYESRRQNQDRINKTVLYGTPRKCFVGQSKPNHPLLQAKPQSEPDYLEVLEKQT
AISQL
Download sequence
Identical sequences A0A0D9SA24 A0A2I3SRS3
ENSGGOP00000016064 XP_003816853.1.60992 XP_004065022.1.27298 XP_007991079.1.81039 XP_007991080.1.81039 XP_007991081.1.81039 XP_007991083.1.81039 XP_007991084.1.81039 XP_007991085.1.81039 XP_007991086.1.81039 XP_007991087.1.81039 XP_007991088.1.81039 XP_007991089.1.81039 XP_008968154.1.60992 XP_008968155.1.60992 XP_009438003.2.37143 XP_016799835.1.37143 XP_016799836.1.37143 XP_016799837.1.37143 XP_016799838.1.37143 XP_016799839.1.37143 XP_016799841.1.37143 XP_016799842.1.37143 XP_016799843.1.37143 XP_016799844.1.37143 XP_016799846.1.37143 XP_016802937.1.37143 XP_016802938.1.37143 XP_016802939.1.37143 XP_016802940.1.37143 XP_016802941.1.37143 XP_016802942.1.37143 XP_016802944.1.37143 XP_016802945.1.37143 XP_016802946.1.37143 XP_016802947.1.37143 XP_016802948.1.37143 XP_016802950.1.37143 XP_018875376.1.27298 XP_018875377.1.27298 ENSGGOP00000016064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]