SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016086 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016086
Domain Number 1 Region: 65-125
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016086   Gene: ENSGGOG00000016493   Transcript: ENSGGOT00000016544
Sequence length 235
Comment pep:known_by_projection chromosome:gorGor3.1:17:1187628:1188335:1 gene:ENSGGOG00000016493 transcript:ENSGGOT00000016544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGAPGLGLTARKGAEGSAEDLGGPCPEPGGDSGVLGANGASCSRGEAEEPAGRRRARP
VRSKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLV
LRASPAPRGPCGHLECHGPAARGDTGDTGASPPPPAGPSLARPDAARPSVPSAPRCASCP
RQAPLARPSAVAEGPGLAQASGGSWRRCPGASSAGPPPWPRGYLRSAPGMGHPRS
Download sequence
Identical sequences G3RK30
ENSGGOP00000016086 XP_004058269.1.27298 ENSGGOP00000016086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]